SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000276 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000276
Domain Number 1 Region: 41-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-38
Family Galectin (animal S-lectin) 0.00032
Further Details:      
 
Domain Number 2 Region: 210-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-18
Family Galectin (animal S-lectin) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000276   Gene: ENSGGOG00000000279   Transcript: ENSGGOT00000000282
Sequence length 337
Comment pep:known_by_projection chromosome:gorGor3.1:11:60311885:60322904:1 gene:ENSGGOG00000000279 transcript:ENSGGOT00000000282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAG
KMVVLQGVVPLDAHSRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQR
EARWPHLALRRGSSFLILFLFVNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEA
VGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHF
TVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLK
LALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS
Download sequence
Identical sequences G3QDF8
ENSGGOP00000000276 ENSGGOP00000000276 XP_018891512.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]