SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000294 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000294
Domain Number 1 Region: 91-192
Classification Level Classification E-value
Superfamily PDZ domain-like 1.24e-23
Family PDZ domain 0.026
Further Details:      
 
Domain Number 2 Region: 623-708
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-21
Family PDZ domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 411-511
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-21
Family PDZ domain 0.00000658
Further Details:      
 
Domain Number 4 Region: 517-611
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-20
Family PDZ domain 0.00000813
Further Details:      
 
Domain Number 5 Region: 190-294
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-19
Family PDZ domain 0.0000992
Further Details:      
 
Domain Number 6 Region: 6-93
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-18
Family PDZ domain 0.011
Further Details:      
 
Domain Number 7 Region: 945-1043
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-18
Family PDZ domain 0.00000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000294   Gene: ENSGGOG00000000298   Transcript: ENSGGOT00000000300
Sequence length 1081
Comment pep:known_by_projection chromosome:gorGor3.1:12:64670707:64869008:-1 gene:ENSGGOG00000000298 transcript:ENSGGOT00000000300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKGVNG
INLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVIFRTVEVTLHKEGNTFGFVR
GGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCG
QEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTTSMCCNKQVIVIDKIKSAS
IADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEILPHHQTRLALKGPDH
VKIQRSDRQLTWDSWASNHSSLHTNHHYNTYHPDHCRVPALTFPKAPPPNSPPALVSSSF
SPTSMSAYSLSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSLSLASSTVGLAGQVVH
TETTEVVLTADPVTGFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAI
NGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHNVELGIT
ISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQCE
DLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGL
AERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQSASSPKKFP
ISSHLSDLGDVEEDSSPAQKPGKLSDMYPSTVPSVDSAVDSWDGSAIDTSYGTQGTSFQA
SGYNFNTYDWRSPKQRGSLSPVTKPRSQTYPDVGLSNEDWDRSTASGFAGAADSAETEQE
ENFWSQALEDLETCGQSGILRELEEKADRRVSLRNMTLLATIMSGSTMSLNHEAPTPRSQ
LGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTL
YKDSDMEDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLV
VPLIAESGNKLDLVISRNPLASQKSIEQQSLPGDWSEQNSAFFQQPSHGGNLETREPTNT
L
Download sequence
Identical sequences ENSGGOP00000000294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]