SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000296 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000296
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000189
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000296   Gene: ENSGGOG00000000300   Transcript: ENSGGOT00000000302
Sequence length 303
Comment pep:known_by_projection chromosome:gorGor3.1:14:50810589:50867602:1 gene:ENSGGOG00000000300 transcript:ENSGGOT00000000302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHGRIAPKSTSVFAVASVGHGVFLPLVILCTLLGDGLASVCPLPPEPENGGYICHPRPC
RDPLTAGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLS
IVASTASSVALILLLVVLFVLLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEA
VYGSSGHCVPPADPRVQIVLSEGSGPSGRSVPREQQLPDQGACSSAGGEDEAPGQSGLCE
AWGSRGSETVMVHQATTSSWVAGSGNRQLAHKETTDSENSDIQSLLSLTSEEYTDDIPLL
KEA
Download sequence
Identical sequences G3QDH7
XP_018865651.1.27298 ENSGGOP00000000296 ENSGGOP00000000296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]