SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000314 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000314
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 3.92e-32
Family Pleckstrin-homology domain (PH domain) 0.000000242
Further Details:      
 
Domain Number 2 Region: 169-262
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000356
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000314   Gene: ENSGGOG00000000321   Transcript: ENSGGOT00000000322
Sequence length 295
Comment pep:known_by_projection chromosome:gorGor3.1:4:75908737:75952837:1 gene:ENSGGOG00000000321 transcript:ENSGGOT00000000322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLVKRSGYREYEHYWTELRGTTLFFYTDK
KSIIYVDKLDIVDLICLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFY
TVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIEL
EKPVTLPNLFSVIDYFVKETRGNLKPFICSTDENTGQEPNMEGRSEKLKKNPHIA
Download sequence
Identical sequences ENSGGOP00000000314 ENSGGOP00000000314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]