SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000341 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000341
Domain Number 1 Region: 46-179
Classification Level Classification E-value
Superfamily EF-hand 6.66e-47
Family p25-alpha 0.00000892
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000341   Gene: ENSGGOG00000000348   Transcript: ENSGGOT00000000350
Sequence length 219
Comment pep:known_by_projection chromosome:gorGor3.1:17:93553714:93575269:1 gene:ENSGGOG00000000348 transcript:ENSGGOT00000000350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAV
HGDTRATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEAL
EELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERF
DPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Download sequence
Identical sequences H2PF27
ENSGGOP00000000341 9600.ENSPPYP00000017098 ENSPPYP00000017098 ENSGGOP00000000341 ENSPPYP00000017098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]