SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000348 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000348
Domain Number 1 Region: 53-307
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.14e-23
Family G proteins 0.056
Further Details:      
 
Domain Number 2 Region: 443-531
Classification Level Classification E-value
Superfamily EF-hand 1.64e-22
Family Eps15 homology domain (EH domain) 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000348   Gene: ENSGGOG00000000355   Transcript: ENSGGOT00000000357
Sequence length 534
Comment pep:known_by_projection chromosome:gorGor3.1:11:61680858:61711699:-1 gene:ENSGGOG00000000355 transcript:ENSGGOT00000000357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPM
VLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRR
PFRKLNAFGNAFLNRYPPITLKSTLLRRPAVQSIPGVLKGQRKRCAESYDFAAILEWFAE
RVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSL
GKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKR
ARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQ
ELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNG
PFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTV
LGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Download sequence
Identical sequences ENSGGOP00000000348 ENSGGOP00000000348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]