SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000372 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000372
Domain Number 1 Region: 1-344
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.81e-24
Family L-arabinose binding protein-like 0.0068
Further Details:      
 
Domain Number 2 Region: 368-404,511-557
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000000899
Family Phosphate binding protein-like 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000372
Domain Number - Region: 400-515
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00222
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000372   Gene: ENSGGOG00000000378   Transcript: ENSGGOT00000000381
Sequence length 583
Comment pep:known_by_projection chromosome:gorGor3.1:4:102138700:102570218:1 gene:ENSGGOG00000000378 transcript:ENSGGOT00000000381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDDY
TLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVEN
NINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIIIN
EEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNMEI
SNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKKGGVSGLT
GELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPVTGLNGSLTDKKLENNMRGVV
LRVVTVLRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFACLAPFDLS
LWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGGEVPYTTL
ATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQTEIPYGTVLDSAVY
EHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQK
Download sequence
Identical sequences ENSGGOP00000000372 ENSGGOP00000000372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]