SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000374 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000374
Domain Number 1 Region: 50-574
Classification Level Classification E-value
Superfamily SNF-like 1.27e-185
Family SNF-like 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000374   Gene: ENSGGOG00000000379   Transcript: ENSGGOT00000000383
Sequence length 632
Comment pep:known_by_projection chromosome:gorGor3.1:3:11145266:11251542:1 gene:ENSGGOG00000000379 transcript:ENSGGOT00000000383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEKALPLGNGKAAEEARESEAPGGGCSSGGAAPARDPRDKRDKAVHERGHWNNKVEFV
LSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGIT
CWRKVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENC
VEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLRWELALCLLAAWTICY
FCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWV
DAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMA
YEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVT
AVVDMYPKVFRRGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVA
IFECICIGWVYGSNRFYDNIEDMIGYRPPSLIKWCWKIMTPGICAGIFIFFLIKYKPLKY
NNIYTYPAWGYGIGWLMALSSMLCIPLWICITVWKTEGTLPEKLQKLTTPSTDLKMRGKL
GVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
Download sequence
Identical sequences A0A2I2YL32
XP_004033660.1.27298 ENSGGOP00000000374 ENSGGOP00000000374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]