SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000375 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000375
Domain Number 1 Region: 379-610
Classification Level Classification E-value
Superfamily GFP-like 2.2e-91
Family Domain G2 of nidogen-1 0.00000000137
Further Details:      
 
Domain Number 2 Region: 893-1129
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-46
Family YWTD domain 0.000000000824
Further Details:      
 
Domain Number 3 Region: 761-869
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.75e-25
Family Thyroglobulin type-1 domain 0.00053
Further Details:      
 
Domain Number 4 Region: 622-702,738-791
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000487
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 5 Region: 1158-1194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000207
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000375   Gene: ENSGGOG00000000381   Transcript: ENSGGOT00000000384
Sequence length 1197
Comment pep:known_by_projection chromosome:gorGor3.1:1:216260830:216347258:-1 gene:ENSGGOG00000000381 transcript:ENSGGOT00000000384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDLVSPALELS
GALRFYDRSDIDSVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKV
YYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQ
AVLASSDSSSYAIFLYPEDGLQFHTTFSKKENNQVPAVVAFSQGSVGFLWKSNGAYNIFA
NDRESIENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVILGTEDGAEYDDEDEDYDLET
TRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERTRSFQLAVETF
HQQHPQVIDVDEVEETGVGSPQRVNGKVKGRIFVGSSQIPIVFENTDLHSYVVMNHGRSY
TAISTIPETVGYSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGN
LVIKQRFSGIDEHGHLTIDTELEGRVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYT
VTEPERDGASPSRIYTYQWRQTITFQECIHDDSRPALPSTQQLSVDSVFVLYNQEERILR
YALSNSIGPVREGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYD
IDECSEQPSVCGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCD
IPQRARCIYTGGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKP
GYQGDGFRCVPGEVEKTRCQHEREHILGAAGAADPQRPIPPGLFVPECDAHGHYAPTQCH
GSTGYCWCVDRDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQ
TGKIERLPLEGNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGG
EPTTIIRQDLGSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIV
TDSVTGNLYWTDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDAGT
NRAECLNPSQPPRRKVLEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPH
KQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Download sequence
Identical sequences ENSGGOP00000000375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]