SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000401 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000401
Domain Number 1 Region: 159-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.52e-37
Family Eukaryotic proteases 0.00058
Further Details:      
 
Domain Number 2 Region: 65-126
Classification Level Classification E-value
Superfamily GLA-domain 2.94e-22
Family GLA-domain 0.00053
Further Details:      
 
Domain Number 3 Region: 115-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000401   Gene: ENSGGOG00000000407   Transcript: ENSGGOT00000000410
Sequence length 422
Comment pep:known_by_projection chromosome:gorGor3.1:13:96380894:96396350:1 gene:ENSGGOG00000000407 transcript:ENSGGOT00000000410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCVPLLQGLVLVLALHRVEPSATSLKERHGLHSDSACTGVQESLFLPASKANDVLVRW
KRAGSYLLEELFEGNLEKECYEEICVYEEAREVFENEVVTDEFWRRYKGGSPCISQPCLH
NGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRL
GEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAK
CSLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGL
PVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTQPVTLVEGEECGQVLNVTVTTR
AYCERSSVAAMHWMEGSVVTREHGGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKRI
MN
Download sequence
Identical sequences ENSGGOP00000000401 ENSGGOP00000000401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]