SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000422 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000422
Domain Number 1 Region: 228-298
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000015
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number 2 Region: 32-56
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000144
Family CCCH zinc finger 0.0043
Further Details:      
 
Domain Number 3 Region: 3-27
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000034
Family CCCH zinc finger 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000422
Domain Number - Region: 166-190
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00017
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 324-352
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000471
Family CCCH zinc finger 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000422   Gene: ENSGGOG00000000429   Transcript: ENSGGOT00000000431
Sequence length 416
Comment pep:known_by_projection chromosome:gorGor3.1:3:12908146:12934118:1 gene:ENSGGOG00000000429 transcript:ENSGGOT00000000431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSA
AAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAEG
KTQPSMASNPGSCSDPQPSPEMKPHSYLDAIRSGLDEVEASSSYSNEQQLCPYAAAGECR
FGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSI
CMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIP
SVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKP
RKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
Download sequence
Identical sequences A0A2I2ZL53
XP_004033682.1.27298 ENSGGOP00000000422 ENSGGOP00000000422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]