SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000435 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000435
Domain Number 1 Region: 773-851
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.57e-26
Family VHP, Villin headpiece domain 0.0000829
Further Details:      
 
Domain Number 2 Region: 125-188
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.06e-16
Family LIM domain 0.0023
Further Details:      
 
Domain Number 3 Region: 182-218
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000487
Family LIM domain 0.0015
Further Details:      
 
Domain Number 4 Region: 252-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000107
Family LIM domain 0.0035
Further Details:      
 
Domain Number 5 Region: 224-251
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000371
Family LIM domain 0.01
Further Details:      
 
Domain Number 6 Region: 87-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000748
Family LIM domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000435
Domain Number - Region: 273-305
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000127
Family LIM domain 0.01
Further Details:      
 
Domain Number - Region: 314-345
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00152
Family LIM domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000435   Gene: ENSGGOG00000000440   Transcript: ENSGGOT00000000444
Sequence length 851
Comment pep:known_by_projection chromosome:gorGor3.1:10:128361290:128593689:-1 gene:ENSGGOG00000000440 transcript:ENSGGOT00000000444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAFLGLKCLGKLCSSEKSKVTSSERTSARGSNRKRLIVEDWRVSGTSFAAHRRATITHL
LYLCPKDYCPRGRVCNSVDPFVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHI
KCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPN
CFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALL
ALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLECG
SEKYKTPSCGKHERCRVMKIQGVHSVFSGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFF
YPKSLIRRTGRSPSLQPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPK
VKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRST
SQGSINSPVYSRHSYTPTTSRSPQHFHRPELLSPGVQRLSYLRTSSLSPTHSDSRPNPPF
RHHFIPHIKGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQH
DAAALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAAVELGPDMKRRSS
GREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASH
IPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSM
PNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWR
RNDMKKKAKLF
Download sequence
Identical sequences ENSGGOP00000000435 ENSGGOP00000000435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]