SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000454 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000454
Domain Number 1 Region: 2-565
Classification Level Classification E-value
Superfamily ARM repeat 2.63e-106
Family Clathrin adaptor core protein 0.0000000000000223
Further Details:      
 
Domain Number 2 Region: 675-803
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 1.05e-44
Family Alpha-adaptin ear subdomain-like 0.000000275
Further Details:      
 
Domain Number 3 Region: 804-917
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 6.67e-44
Family Clathrin adaptor appendage, alpha and beta chain-specific domain 0.000000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000454   Gene: ENSGGOG00000000458   Transcript: ENSGGOT00000000463
Sequence length 917
Comment pep:known_by_projection chromosome:gorGor3.1:11:895930:973468:1 gene:ENSGGOG00000000458 transcript:ENSGGOT00000000463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLL
SSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMGLALHCIASVGSREM
AEAFAGEIPKVLVAGDTMDSVKQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLNDQHLGV
VTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSASTDLQDYTYYFVPAPWLSVKLLR
LLQCYPPPEDPAVRGRLTECLETILNKAQEPPKSKKVQHSNAKNAVLFEAISLIIHHDSE
PNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEFSHEAVKTHIETVINALKTERDV
SVRQRAVDLLYAMCDRSNAPQIVAEMLSYLETADYSIREEIVLKVAILAEKYAVDYTWYV
DTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAAKTVFEALQAPACHENLVKVGGYI
LGEFGNLIAGDPRSSPLIQFHLLHSKFHLCSVPTRALLLSTYIKFVNLFPEVKPTIQDVL
RSDSQLRNADVELQQRAVEYLRLSTVASTDILATVLEEMPPFPERESSILAKLKKKKGPS
TVTDLEDTKRDRSVDVNGGPEPAPASTSAVSTPSPSADLLGLGAAPPAPTGPPPSSSGSG
LLVDVFSDSASVVAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFY
GNKTSTQFLNFTPTLICSDDLQPNLNLQTKPVDPTVEGGAQVQQVVNIECVSDFTEAPVL
NIQFRYGGTFQNVSVQLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMD
TEVTKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRT
SKEAVSQRLCELLSAQF
Download sequence
Identical sequences G3QDX3
ENSGGOP00000000454 ENSGGOP00000000454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]