SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000461 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000461
Domain Number 1 Region: 48-122
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000173
Family Splicing factor U2AF subunits 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000461
Domain Number - Region: 122-145
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00314
Family CCCH zinc finger 0.0067
Further Details:      
 
Domain Number - Region: 17-36
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0424
Family CCCH zinc finger 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000461   Gene: ENSGGOG00000000469   Transcript: ENSGGOT00000000472
Sequence length 208
Comment pep:novel chromosome:gorGor3.1:11:69178938:69179971:1 gene:ENSGGOG00000000469 transcript:ENSGGOT00000000472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYLASIFGTGKDKVSCYFRIGACCHGDRCSRLHNKPTFSAMSDVEMQEHYDEFFERVF
TEMEEKYGEVEEMNVCDNQGDHLVGNMYFRREEDAEKAVIDLYNRWFNRQPIHAELSPVT
DFREACCSQYEMGECTRGGFCNFTHLKTISRELPRELYGCHLKKHRSRSQSREHNSRSRD
HGGGGGGGGGRWERDRRRLRDHERSGQF
Download sequence
Identical sequences ENSGGOP00000000461 ENSGGOP00000000461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]