SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000465 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000465
Domain Number 1 Region: 18-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.06e-58
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 235-277
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000693
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000465   Gene: ENSGGOG00000000473   Transcript: ENSGGOT00000000476
Sequence length 278
Comment pep:known_by_projection chromosome:gorGor3.1:10:5789855:5822618:-1 gene:ENSGGOG00000000473 transcript:ENSGGOT00000000476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIDSGACVNQVTVDSITPLHAAS
LQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASP
LHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAK
LHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPL
TLSQLCRVSLRKATGVRGLEKIAKLNIPPRLIDYLSYN
Download sequence
Identical sequences G3QDY4
XP_004049067.1.27298 ENSGGOP00000000465 ENSGGOP00000000465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]