SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000492 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000492
Domain Number 1 Region: 189-313
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.37e-37
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.000000245
Further Details:      
 
Domain Number 2 Region: 4-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.44e-36
Family Interferon regulatory factor 0.000000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000492   Gene: ENSGGOG00000000499   Transcript: ENSGGOT00000000504
Sequence length 441
Comment pep:known_by_projection chromosome:gorGor3.1:19:46990464:46995613:-1 gene:ENSGGOG00000000499 transcript:ENSGGOT00000000504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGHFSQP
DTSLDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDSPT
PFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCLEGLRLVGSEVGDRTLPG
WPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVXDDKSGSWAPRSDYLHGRKRTLTTLCPLVLCGGVMAPGPAVDQEARDGQ
GCAHVPQGLGRNGPGRGCLLPGEHCGPAHFQQPPTLPHLRPVQGLPAGLGGRNGFPGPWG
DLSPRSSWCASNPPVPHHLNQ
Download sequence
Identical sequences ENSGGOP00000000492 ENSGGOP00000000492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]