SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000504 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000504
Domain Number 1 Region: 424-579
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-33
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 637-789
Classification Level Classification E-value
Superfamily Spectrin repeat 3.5e-32
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 318-465
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-30
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 4 Region: 756-896
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-28
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 5 Region: 1237-1393
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-28
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 1662-1781
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-27
Family Spectrin repeat 0.0000782
Further Details:      
 
Domain Number 7 Region: 122-261
Classification Level Classification E-value
Superfamily Spectrin repeat 5.28e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1767-1926
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-26
Family Spectrin repeat 0.000086
Further Details:      
 
Domain Number 9 Region: 1347-1487
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-25
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 10 Region: 1554-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 4.94e-25
Family Spectrin repeat 0.0000715
Further Details:      
 
Domain Number 11 Region: 19-154
Classification Level Classification E-value
Superfamily Spectrin repeat 6.77e-25
Family Spectrin repeat 0.000000161
Further Details:      
 
Domain Number 12 Region: 2038-2150
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-24
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 13 Region: 977-1058
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-19
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 14 Region: 900-964,1042-1080
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-18
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 15 Region: 1895-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-17
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 16 Region: 2157-2264
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 17 Region: 2265-2416
Classification Level Classification E-value
Superfamily EF-hand 2.18e-16
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 18 Region: 1088-1182
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000273
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000504   Gene: ENSGGOG00000000508   Transcript: ENSGGOT00000000516
Sequence length 2419
Comment pep:known_by_projection chromosome:gorGor3.1:1:137610762:137697564:-1 gene:ENSGGOG00000000508 transcript:ENSGGOT00000000516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFPKETVVESSGPKVLETAEEIQERRQEVLTRYQRFKERVAERGQKLEDSYHLQVFKR
DADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFT
MGHSAHEETKAHIEELRRLWDLLLELTLEKGDLLLRALKFQQYVQECADILEWIGDKEAI
ATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQN
EVNAAWERLRGLALQRQKALSNAADLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASE
GLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSNWEHIRALAT
SRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEID
SYDDRFQSADETGQDLLNANHEASDEVREKMEILDNNWTALRELWDKRHHQYEQCLDFHL
FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKITTVDKTAT
KLIGDDHYDSENIKAIRDGLLARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINK
KKKLADDEDYKDIQNLKSRVQKQQVFEKELEVNKTLLENIQKTGQEMIEHGHYASDNVTT
RLSEVASLWKELMEATEQKGTQLHEANQLLQFENNAEDLQRWLEDVEWQVTSEDYGKGLA
DVQNRLRKHGLLESAVAARQDQVDILTDLAAYFEEIGHPDSKDIRARQESLVCRFEALKE
PLATRKKKLLDLLHLQMICRDTEDEEAWIQETEPSATSSYLGKDLIASKKLLNRHRVILE
NIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESLRARAARRQNNLEANVQ
FQQYLADLHEAETWIREKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNSFGDSMKALQN
QANACQQQQAAPVEGAAGEQRVMALYDFQARGPREVTMKKGDVLTLLSSINKDWWKVEAA
DHQGIVPAVYVRRLAHDEFPMLPKRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQ
RYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNANEPRLRDINKV
ADDLLFEGLLTPEGAQIRQELNARWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIE
KKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDKVTILGETAERLSESHPDATEDL
QRQKMELNEAWEDLQGRTKDCKESLNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAED
LTGIEILLERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQAVKLERDDL
EKAWEQRKKILDQCLELQMFQGNCDQVESWMVARENSLRSDDKGSLDSLEALMKKRDDLD
KAITAQEGKITDLEHFAERLIADEHYAKEEIATRLQRVLDRWKALKAQLIDERTKLGDYA
DLKQFYRNLEELEEWISEMLPTACDESYKDPTNIQRKYLKHQTFANEVYGRSHQVDGVIN
LGNSLIERSACDGNEEAMKEHLEWLKEHWVHLLERTTDKGQKLNEASRQQRFNTSIQDFE
FWLSEAETLLAMKDQARDLASAGNLLKKHQLLETEMLAREDALKDLNTLAADLLSSGTFN
VDQIMEKTDDVNKRFLNVQDLAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQD
YGRDLQGVQNLLKKHKRLEGELVAHEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEH
WEKLKELAKARGLKLEESLEYLQFMQNAEEEEAWINEKNALAARGDSGDTLAATQSLLMK
HEALENDFAVHETRVQNVCAQGEDILNKVLQEESQNKEISSKIEALNEKTPSLAKAIAAW
KLQLEDDYVFQEFNWKADVVEAWIADKETSLKTNGNGADLGDFLTLLAKQDALDASLQSF
QQERLPEITDLKDKLIAAQHNQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQK
AEDLFMEFAHKASALNNWCEKMEENLSEPVHCVSLNEIRQLQRDHEDFLASLAGAQADFK
CLLELDQQIKALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQKEEARQVKNFEMCQ
EFEQNASTFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIVDLG
DNLEDALILDIKYSTIGLAQQWDQLYQLGLRMQHNLEQQIQAKDTKGVSEETLKEFSTIY
KHFDENLTGRLTHKEFRSCLRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYT
AFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG
RSHLSGYDYVGFTNSYFGN
Download sequence
Identical sequences ENSGGOP00000000504 ENSGGOP00000000504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]