SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000531 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000531
Domain Number 1 Region: 20-274
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.87e-66
Family Ankyrin repeat 0.0000696
Further Details:      
 
Domain Number 2 Region: 253-385
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000109
Family Ankyrin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 460-510
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000068
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000531   Gene: ENSGGOG00000000538   Transcript: ENSGGOT00000000544
Sequence length 526
Comment pep:known_by_projection chromosome:gorGor3.1:2a:54638734:54757310:-1 gene:ENSGGOG00000000538 transcript:ENSGGOT00000000544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIKQMDFTEAYADTCSTVGLAAREGNVKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSV
ECLQMLINADSSENYIKMKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPL
FLAVENGQIDVLRLLLQHGANVNGSHSMCGWNSLHQASFQENAEIIKLLLRKGANKECQD
DFGITPLFVAAQYGKLESLSILISSALGANVNCQALDKATPLFIAAQEGHTKCVELLLSS
GADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNKVSPVYSAVFGGHED
CLEILLRNGYSPDAQACLVFGFSSPVCMAFQKEWSCEFFGIVNILLKYGAQINELHLAYC
LKYEKFSIFRYFLRKGCSLGPWNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNS
WIDSVSIDTLIFTLEFTNWKTLAPAVERMLSARASNAWILQQHIATVPSLTHLCRLEIRS
SLKSERLRSDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQDG
Download sequence
Identical sequences ENSGGOP00000000531 ENSGGOP00000000531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]