SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000541 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000541
Domain Number 1 Region: 73-394
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.31e-62
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 389-524
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.53e-31
Family Ricin B-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000541   Gene: ENSGGOG00000000550   Transcript: ENSGGOT00000000554
Sequence length 529
Comment pep:known_by_projection chromosome:gorGor3.1:1:210348675:210454847:1 gene:ENSGGOG00000000550 transcript:ENSGGOT00000000554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDWNEIDPIKKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEVYVGGTMVRSGQDPYARN
KFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKK
SPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTF
LDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKW
DYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRV
WQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPS
ARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGH
FADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKW
EQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
Download sequence
Identical sequences G3QE54
ENSGGOP00000000541 ENSGGOP00000000541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]