SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000544 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000544
Domain Number 1 Region: 29-158
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-35
Family C-type lectin domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000544   Gene: ENSGGOG00000000553   Transcript: ENSGGOT00000000557
Sequence length 158
Comment pep:known_by_projection chromosome:gorGor3.1:1:122970979:122989147:-1 gene:ENSGGOG00000000553 transcript:ENSGGOT00000000557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRSTQLLLLLSCLAKTGVLGDIIMRPSYAPGWFYHKSNCYGYFRKLRNWSDAELECQS
YGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSG
KSMGGNKHCAEMSSNNNFLTWSSNECNKHQHFLCKYRP
Download sequence
Identical sequences G3QE57
ENSGGOP00000000544 XP_004026498.1.27298 XP_018876728.1.27298 ENSGGOP00000000544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]