SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000546 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000546
Domain Number 1 Region: 160-357
Classification Level Classification E-value
Superfamily E set domains 5.6e-81
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000989
Further Details:      
 
Domain Number 2 Region: 38-86,116-176
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.48e-23
Family Voltage-gated potassium channels 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000546   Gene: ENSGGOG00000000554   Transcript: ENSGGOT00000000559
Sequence length 445
Comment pep:known_by_projection chromosome:gorGor3.1:22:22778986:22808378:-1 gene:ENSGGOG00000000554 transcript:ENSGGOT00000000559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVAAAGGPAAGGGGAAPVAPKPCIMHVNG
FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK
RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR
DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT
TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV
LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG
SHLDLERMQASLPLDNISYRRESAI
Download sequence
Identical sequences G3QE59
ENSGGOP00000000546 XP_004063517.1.27298 XP_004063518.1.27298 XP_018873480.1.27298 ENSGGOP00000000546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]