SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000552 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000552
Domain Number 1 Region: 884-1049
Classification Level Classification E-value
Superfamily EF-hand 3.92e-25
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 2 Region: 726-872
Classification Level Classification E-value
Superfamily EF-hand 5.21e-17
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000552   Gene: ENSGGOG00000000558   Transcript: ENSGGOT00000000565
Sequence length 1150
Comment pep:known_by_projection chromosome:gorGor3.1:3:136104605:136291856:1 gene:ENSGGOG00000000558 transcript:ENSGGOT00000000565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPV
SQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFA
SGKIKEFSLEKLKNSNHAAYRKGRKVKSDSFNRRSVDLDLLCGHYNNDGNAPSFGLLRSS
SVEEKPLSHRNSLDMNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCS
EDLKKCTDIIKQCIKRKSGSSISEGSGNDTISSSETVYMNVMTRLASYLKKLPFEFMQSG
NNEAPDLTELISNMPSLQLTPFSPVFGTEQPPKYEDVVQLSASDSGQFQTIELQNDKPNS
RKMDTVQSIPNNSTNSLYNLEVNDPRTLKAVQVQSQSLTMNPLENVSSDDLMETLYIEEE
SDGKKALDKGQKTENGPSHELLKVNEHRAEFPEHATHLKKCPTPMQNEIAKIFEKSFVNL
PKEDCKSKVSKFKEGNQRDFTNSNSQEEIDKLLMDLESFSQKMETSLREPLAKGKNSNSL
NSHSQLTGQTLVDLEPKSKVSSPIEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIED
FAQELVECKSSRGSLSQEKEMMQILQETLTTSSQANLSVCKSPVGDKAKDTTSAVLIQQT
PEVIKIQNKPEKKPGTPLPPPATSPSSPRPLSPVPHVNNVVNAPLSINIPRFYFPEGLPD
TCSNHEQTLSRIETAFMDIEDQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVTA
QSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPE
FHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHF
YVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYAD
FVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHD
LLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDG
PEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKGNKILSANLPEK
CGKLQSVDEE
Download sequence
Identical sequences G3QE64
ENSGGOP00000000552 XP_004037744.1.27298 ENSGGOP00000000552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]