SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000565 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000565
Domain Number 1 Region: 87-263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.68e-41
Family SPRY domain 0.0000578
Further Details:      
 
Domain Number 2 Region: 5-59
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000966
Family RING finger domain, C3HC4 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000565   Gene: ENSGGOG00000000574   Transcript: ENSGGOT00000000578
Sequence length 263
Comment pep:known_by_projection chromosome:gorGor3.1:6:112533263:112537221:1 gene:ENSGGOG00000000574 transcript:ENSGGOT00000000578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRLRAESSCPVCLNFFSCPISLSCTHVFCFDCIQKWLLENHDFRAMCPLCRDVVKVPA
LEEWQVSVLTLMIEQHNNRLEQSLHVREERRRFREDVTLDAATASSLLVFSNDLRSAQCE
KIHHDLTNDPRLTCVLGTPCFSSGQHYWEVEVGEVKSWSLGICKESADRKSNDLFPEHGF
WISMKAGAIHANTDLERIPASPRLHRVGIFLDADLEEIQFFDVDNNVLMYIHDDFFSLEL
LRPFFCLELLGEGESGNILTICP
Download sequence
Identical sequences XP_004044604.1.27298 ENSGGOP00000000565 ENSGGOP00000000565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]