SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000575 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000575
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-40
Family Dual specificity phosphatase-like 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000575
Domain Number - Region: 230-277
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.000589
Family DEK C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000575   Gene: ENSGGOG00000000583   Transcript: ENSGGOT00000000588
Sequence length 1403
Comment pep:known_by_projection chromosome:gorGor3.1:5:54536564:54708318:1 gene:ENSGGOG00000000583 transcript:ENSGGOT00000000588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEADSGEEECRSQPRSISESFLTVKGAALFLPRGNGSSTPRISHRRNKHAGNACIYTISF
LFIISLLSAKFQAVRLESTYQNRTRYMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGL
VLPLWSDTLIHLDGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGS
LFLTWVSYYESHINSDQSSVNEWNAMQDVQSHRPDSPALFTDIPTERERTERLIKTKLRE
IMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSE
WNASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVYDEEATDLLAYWNDTYKFISK
AKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYDYVKERRTVTKPNPSFMRQLE
EYQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKEITTSADQIAEVKTMESH
PPIPPVFVEHMVPQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCL
NESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDALKADMNVHLLPMEELTSPL
KDLPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELG
GGRNESCRLSVVEVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQ
SHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKKNSIHELLLERAQTPENKP
GHMEQDESSCTAQPELAKDSGMCTPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAK
WYPGSVRRATLEFEERLRQEREHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPE
HSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPKVLEFDHLPDPQEDPGSDTGTQQ
EGVLKDLRTVIPYQESETQAVPLPLPKRVEIIEYTHIVTSPNHTGPGSEIATGEKSGEQG
LRKVNMEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSP
EDRGSSLSTALETAAPFISHTTHLLSASLDYLHPQTMVHLEGFTEQSSTTDEPSAEQVSW
EESQESPLSSGSEVPCKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSES
IKSLSHSPGVVKERTKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPAS
CESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKSFVEQLTTTECIVQSKPVE
RPLVQYAKEFGSSQQYLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRT
HPLRRLKKANDKKRTTNPFYNTM
Download sequence
Identical sequences ENSGGOP00000000575 ENSGGOP00000000575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]