SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000588 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000588
Domain Number 1 Region: 138-206
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.82e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 49-116
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000012
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 495-544
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000115
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000588   Gene: ENSGGOG00000000597   Transcript: ENSGGOT00000000602
Sequence length 549
Comment pep:known_by_projection chromosome:gorGor3.1:15:61890129:61893990:-1 gene:ENSGGOG00000000597 transcript:ENSGGOT00000000602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSGGGETLDDQRALQLALDQLSLLGLDSDEGASLYDNEPRKKSVNMTECVPVPSSEHVAE
IVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRAS
RNKNTALNGAVPGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRD
KEPVFEVTGMPENVDRAREEIEAHIALRTGGIIELTDENDFHANGTDVGFDLHHGSGGSG
PGSLWSKPTPSITPTPGRKPFSSYRNDSSSSLGSASTDSYFGGGTSSSATATPRLADYSP
PSPALSFAHNGNNNNNGNGYTYTAGGEASVPSPDGCPELQPTFDPAPAPPPGAPLIWAQF
ERSPGGGPAAPVSSSCSSSASSSASSSSVVFPGGGASAPSNANLGLLVHRRLHPGTSCPR
LSPPLHMAPGVGEHHLARRVRSDPGGGGLAYAAYANGLGAQLPGLQPSDTSGSSSSSSSS
SSSSSSSSGLRRKGSRDCSVCFESEVIAALVPCGHNLFCMECANRICEKSEPECPVCHTA
VTQAIRIFS
Download sequence
Identical sequences ENSGGOP00000000588 ENSGGOP00000000588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]