SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000616 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000616
Domain Number 1 Region: 477-552
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000255
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000616   Gene: ENSGGOG00000000625   Transcript: ENSGGOT00000000631
Sequence length 605
Comment pep:known_by_projection chromosome:gorGor3.1:5:2897164:2932762:-1 gene:ENSGGOG00000000625 transcript:ENSGGOT00000000631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSVTALGQARSSGPGMAPSACCCSPAAVQRRLPILAWLPSYSLQWLKMDFVAGLSVGL
TAIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFHEP
AYAVLLAFLSGCIQLAMGVLRLGFLLDFISYPVIKGFTSAAAVTIGFGQIKNLLGLQNIP
RPFFLQVYHTFLRIAETRVGDAVLGLVCMLLLLVLKLMRDHVPPVHPEMPPGVRLSRGLV
WAATTARNALVVSFAALVAYSFEVTGYQPFILTGETAEGLPPVRIPPFSVTTANGTISFT
EMVQDMGAGLAVVPLMGLLESIAVAKAFASQNNYRIDANQELLAIGLTNMLGSLVSSYPV
TGSFGRTAVNAQSGVCTPAGGLVTGVLVLLSLDYLTSLFYYIPKSALAAVIIMAVAPLFD
TKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSLLMLLHSAARPETKVSEGPV
LVLQPASGLSFPAVEALRKEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQ
KQGVALAFVGLQVGVHWAALGVKLLVLETFIVFSAEKHLRQEPGTQPYNIREDSILDQKV
ALLKA
Download sequence
Identical sequences ENSGGOP00000000616 ENSGGOP00000000616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]