SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000655 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000655
Domain Number 1 Region: 55-258
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 1.57e-45
Family Apolipoprotein A-I 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000655
Domain Number - Region: 273-320
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0275
Family Apolipoprotein A-I 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000655   Gene: ENSGGOG00000000666   Transcript: ENSGGOT00000000671
Sequence length 366
Comment pep:known_by_projection chromosome:gorGor3.1:11:114687905:114690405:-1 gene:ENSGGOG00000000666 transcript:ENSGGOT00000000671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSL
EQDLNNMNKFLEKLRPLSGSEAPRLPQDPVGMRQQLQEELEEVKARLQPYMAEAHELVGW
NLEGLRQQLKPYTMDLMEQVALRVQELQEQLRVVGEDTKAQLLGGVDEARALLQGLQSRV
VHHTGRFKELFHPYAETLVSGIGRHVQELHRSVTPHAPASPARLSRCVQVLSRKLTLKAK
ALHARIQQNLDQLREELSRAFAGTGTEEGAGLDPQVLSEEVRQRLQAFRQDTYLQIAAFT
RAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGH
SHLGDP
Download sequence
Identical sequences G3QEG1
XP_004052225.1.27298 XP_004052226.1.27298 XP_018891288.1.27298 ENSGGOP00000000655 ENSGGOP00000000655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]