SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000656 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000656
Domain Number 1 Region: 233-258,287-484
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-60
Family Voltage-gated potassium channels 0.00041
Further Details:      
 
Domain Number 2 Region: 104-201
Classification Level Classification E-value
Superfamily POZ domain 2.88e-27
Family Tetramerization domain of potassium channels 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000656   Gene: ENSGGOG00000000667   Transcript: ENSGGOT00000000672
Sequence length 575
Comment pep:known_by_projection chromosome:gorGor3.1:1:113613043:113614770:-1 gene:ENSGGOG00000000667 transcript:ENSGGOT00000000672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEHLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNPGYAEPAAGRELPPNMTVVPGDH
MLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK
TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF
SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGARAGASSFSDPFFVVET
LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL
AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV
SNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS
AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Download sequence
Identical sequences G3QEG2
XP_018871446.1.27298 ENSGGOP00000000656 ENSGGOP00000000656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]