SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000658 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000658
Domain Number 1 Region: 169-363
Classification Level Classification E-value
Superfamily E set domains 1.17e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000852
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.29e-23
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000658   Gene: ENSGGOG00000000669   Transcript: ENSGGOT00000000674
Sequence length 433
Comment pep:novel chromosome:gorGor3.1:5:58277477:58325648:-1 gene:ENSGGOG00000000669 transcript:ENSGGOT00000000674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFITCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG
VLEQRPYRRESEI
Download sequence
Identical sequences ENSGGOP00000000658 ENSGGOP00000000658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]