SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000697 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000697
Domain Number 1 Region: 907-1176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.1e-71
Family Tandem AAA-ATPase domain 0.0000319
Further Details:      
 
Domain Number 2 Region: 647-905
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-54
Family Tandem AAA-ATPase domain 0.000049
Further Details:      
 
Domain Number 3 Region: 405-455,483-526
Classification Level Classification E-value
Superfamily Chromo domain-like 2.2e-17
Family Chromo domain 0.021
Further Details:      
 
Domain Number 4 Region: 546-617
Classification Level Classification E-value
Superfamily Chromo domain-like 2.75e-17
Family Chromo domain 0.0044
Further Details:      
 
Domain Number 5 Region: 290-363
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.86e-17
Family PHD domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000697
Domain Number - Region: 132-171
Classification Level Classification E-value
Superfamily HMG-box 0.000434
Family HMG-box 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000697   Gene: ENSGGOG00000000708   Transcript: ENSGGOT00000000713
Sequence length 1928
Comment pep:known_by_projection chromosome:gorGor3.1:1:6218651:6311479:-1 gene:ENSGGOG00000000708 transcript:ENSGGOT00000000713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEDGGLEAFDDFFPVEPVSLPKKKKPKKLKENKCKGKRKKKEGSNDELSENEEDLEEKS
ESEGSDYSPNKKKKKKLKDKKEKKAKRKKKDEDEDDNDDGCLKEPKSSGQLMAEWGLDDV
DYLFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSANNPFKGSSA
AAAAAAVAAAVETVTISPPLAVSPPQVPQPVPIRKAKTKEGKGPGVRKKIKGSKDGKKKG
KGKKTAGLRFRFGGISNKRKKGSSSEEDEREESDFDSASIHSASVRSECSAALGKKSKRR
RKKKRIDDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPH
CEKEGIQWEPKDDDDEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPP
LPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFMVGLPGPDVEPSLPPPKPLEGI
PEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGDEDGKSE
KRKNKDPLYAKMEERFYRYGIKPEWMMIHRILNHSFDKKGDVHYLIKWKDLPYDQCTWEI
DDIDIPYYDNLKQAYWGHRELMLGEDTRLPKRLLKKGKKLRDDKQEKPPDTPIVDPTVKF
DKQPWYIDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEG
HSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRSGK
KVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFFRVLNSY
KIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGP
HMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQVSLLNIM
MDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIF
SQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLG
INLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKM
MLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGMMSQGQRPVTPIPDVQSSK
GGNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLS
SFKVAQYVVREEDGVEEVEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIR
KQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQLKSDRDK
PLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRA
YVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYST
PDLIPEGPEGKKPGEVISSDPNTPVPASPAHLLPAPLGLPDKMEAQLGYMDEKDPGAQKP
RQPLEVQALPAALDRVESEDKHENPASKERAREERPEEMEKALPSPEQLPREEVLPEKEK
ILDKLELSLIHSRGDSSELRPDDTKAEEKEPIETQQNGDKEEDDEGKKEDKKGKFKFMFN
IADGGFTELHTLWQNEERAAVSSGKIYDIWHRRHDYWLLAGIVTHGYARWQDIQNDPRYM
ILNEPFKSEVHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNHPAMALN
ARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIP
PVAARLQMSERSILSRLTNRAGDPTIQQGAFGSSQMYSNNFGPNFRGPGPGGIVNYNQMP
LGPYVTDI
Download sequence
Identical sequences ENSGGOP00000000697 ENSGGOP00000000697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]