SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000718 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000718
Domain Number 1 Region: 1490-1580
Classification Level Classification E-value
Superfamily BRCT domain 2.62e-19
Family 53BP1 0.054
Further Details:      
 
Domain Number 2 Region: 28-134
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.15e-16
Family FHA domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000718
Domain Number - Region: 1587-1667
Classification Level Classification E-value
Superfamily BRCT domain 0.000214
Family BRCT domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000718   Gene: ENSGGOG00000000729   Transcript: ENSGGOT00000000734
Sequence length 1682
Comment pep:known_by_projection chromosome:gorGor3.1:6:31647502:31662224:-1 gene:ENSGGOG00000000729 transcript:ENSGGOT00000000734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMP
DCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRNQEL
ILFADLLCQYHRLDVSLPFVSRGPLTVEETPRVQGGTQPQRLLLAEDSEEEVDFLSERRM
VNKSRTTSSSVIVPESDEEGHSPVLGGLGPPFAFNLNSDTDVEEGQQPAAEEASSAARRG
ATVEAKQSEAEVVTEIQLEKDQPLVKERDDDTKVKRGAGNGVVPAGVILERSQPPGEDSD
TDVDDDSRPPFGFIDSNTDVEEERIPATPVVIPMKKRKIFHGVGTRGPGAPGLAHLQESQ
AGSDTDVEEGRAPQAVPLEKSQASMVINSDTDDEEEVSAALTLAHLKESQPAIWNRDAEE
DMPQRVVLLQRSQTTTERDSDTDVEEEELPVENREAVLKDHTKIRALVRAHSEKDQPPFG
DSDDSVEADKSSPGIHLERSQASTTVDINTQVEKEVPPGAAIIHIKKHQVSVEGTNQTDE
AWPLHGDCETDAEEGTSLAASAVADVRKSQLPAEGDAGAEWTAAVLKQERAHEVGAQGGP
PVAQVEQDLPISRENLTDLVVDTDTLGESTQPQREGAQVPTGREREQHVGGTKDSEDKSD
SEDLDLQATQCFLENQGLEAVQSMEDEPTQAFMLTPPQELGPSHCSFQTTDSDCTLDEPW
EVLATQPFCLRESEDSETQPFDTHLEAYGPCLSPPRAIPGDQHPESPVHTEPMGIQGRGR
QTVDKVMGIPKETAERVGPERGPLERETEKLLPERQTDVTGEEELTKGIQDREQKQLLAR
DTQRQESDKNGESASPERDRESLKVEIETSEEIQVKQREVERPVANRECDPAELEEKVSK
VILERDTQRGEPEGGSQDQKGQASSPTLEPGVGVGDLPGPTSAPVPSGSQSGGRGSPVSP
RRHQKGLLNCKMPPAEKASRIRAAEVSRVRATFSTSYSTSHLYVFSNALSPSLTLIYSFL
IIQFYLFPKLYLLPDSKERPFVFLLSLPQPSFSLPSSTCGEHYSSIMETGLWEKGSFPGR
SQSNGGEIIDRKENPGNLVSLSNHKQVSRTVSKGDQESPDACLPPTVPEAPAPPQKPLNS
HSQKHLAPPPLLSPLLPSIKPTVRKTRQDGSQEAPEAPLSSELEPFHPKPKIRTWKSSRM
TPFPATSAAPEPHPSTSTAQPVTPKPTSQATRSRTNRSSVKTPKPVEPAASDLEPFTPTD
QSVTPEAIAQGGQSKTLRSSTVRAMAVPTTPEFQSPVTTDQPISPEPITQPSCIKRQRAA
GNPGSLAAPIDHKPCSAPLEPKSQASRNQRWRAVRAAESLTAIPEPASPQLLETPTHASQ
IQKVEPAGRSRFTPELQPKASQSRKRSLATMDSPPHQKQPQRGEVSQKTVIIKEEEEDTA
EKPGKEEDVVTPKPGKRKRDQAEEESNRIPSRSLRRTKLNQESTAPKVLFTGVVDARGER
AVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDE
YVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLP
SMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLEMS
ST
Download sequence
Identical sequences ENSGGOP00000000718 ENSGGOP00000000718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]