SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000733 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000733
Domain Number 1 Region: 109-270
Classification Level Classification E-value
Superfamily EF-hand 8.15e-23
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 2 Region: 13-147
Classification Level Classification E-value
Superfamily EF-hand 5.47e-16
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000733   Gene: ENSGGOG00000000743   Transcript: ENSGGOT00000000749
Sequence length 276
Comment pep:known_by_projection chromosome:gorGor3.1:6:26517314:26566980:1 gene:ENSGGOG00000000743 transcript:ENSGGOT00000000749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSREPTPGRLDAAGFWQVWLRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLH
KVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRQENPLDSSVEFMQIWRKYDAD
SSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILAL
QENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGV
DLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Download sequence
Identical sequences G3QEN6
ENSGGOP00000000733 XP_004043406.1.27298 ENSGGOP00000000733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]