SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000739 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000739
Domain Number 1 Region: 212-414
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.07e-65
Family Reprolysin-like 0.0000037
Further Details:      
 
Domain Number 2 Region: 433-508
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.06e-22
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000739   Gene: ENSGGOG00000000750   Transcript: ENSGGOT00000000755
Sequence length 909
Comment pep:known_by_projection chromosome:gorGor3.1:10:139934863:140320478:-1 gene:ENSGGOG00000000750 transcript:ENSGGOT00000000755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARPLPVSPACALLLALAGALLAPCEARGVSLWNQGRADEVVSASVRSGDLWIPVKSFD
SKNHPQVLNIRIQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCY
YHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPVKKLKSFRGSCG
SHHNTPNLAANNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQR
LIEIANHVDKFYRPLNIRIVLVGVEVWNDVDKCSVSQDPFTSLHEFLDWRKMKLLPRKSH
DNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELGHNFGMNH
DTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGMCLFNLPEVRE
SFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGT
ACRDSSNSCDLPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHEQQCVTLWGPG
AKPAPGICFERVNSAGDPYGNCGKVSKSSFAKCEMRDAKCGKIQCQGGASRPVIGTNAVS
IETNIPLQQGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRQCQNISVFGVHEC
AMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQGLTIGILVTILCL
LAAGFVVYLKRKTLIRLLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPP
DSYPPKDNPRRLLQCQNVDISRPLNGLNVPQPQSTQRVLPPLHRAPRAPSVPARPLPANP
ALRQAQGTCKPNPPQKPLPADPLARTTRLTHALARTPGQRETGLCLAPLRPAPQYPHQVP
RSTHTAYIK
Download sequence
Identical sequences G3QEP0
ENSGGOP00000000739 XP_004050309.1.27298 ENSGGOP00000000739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]