SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000745 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000745
Domain Number 1 Region: 28-107
Classification Level Classification E-value
Superfamily Lysozyme-like 2.57e-29
Family C-type lysozyme 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000745   Gene: ENSGGOG00000000756   Transcript: ENSGGOT00000000761
Sequence length 107
Comment pep:novel chromosome:gorGor3.1:10:33920784:33921616:1 gene:ENSGGOG00000000756 transcript:ENSGGOT00000000761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCLWQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAY
YESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACS
Download sequence
Identical sequences ENSGGOP00000000745 ENSGGOP00000000745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]