SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000749 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000749
Domain Number 1 Region: 312-669
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.13e-126
Family Mammalian PLC 0.0000000000153
Further Details:      
 
Domain Number 2 Region: 954-1154
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 1.2e-52
Family C-terminal domain of PLC-beta 0.000000905
Further Details:      
 
Domain Number 3 Region: 143-308
Classification Level Classification E-value
Superfamily EF-hand 1.66e-49
Family EF-hand modules in multidomain proteins 0.0000000282
Further Details:      
 
Domain Number 4 Region: 11-141
Classification Level Classification E-value
Superfamily PH domain-like 5.47e-44
Family Pleckstrin-homology domain (PH domain) 0.000000141
Further Details:      
 
Domain Number 5 Region: 689-806
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-23
Family PLC-like (P variant) 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000749   Gene: ENSGGOG00000000759   Transcript: ENSGGOT00000000765
Sequence length 1188
Comment pep:known_by_projection chromosome:gorGor3.1:15:18770296:18790361:-1 gene:ENSGGOG00000000759 transcript:ENSGGOT00000000765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGSTSSSKDTGGE
AEGSSPPSAPAGEGTGESGRTMEPVPTELYVAVWAGEEGTESGNLDEEEIKKMQSDEGTA
GLEVTAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAFDLLSKASVQFVEDS
YNKRQMSRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGY
LLKHEFMRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDP
KRRYRTKLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALN
SGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLK
EAMGGLPEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAVISGMSLGRVRG
SLGVGRAGRPGRCCASPGPPQSRGPPAWRSSGSLAELQPPGVGGVGACKLGPGKGSRKKR
SLPREESAGASPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHAAEQISKM
MELAREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINN
SHIQEVVQVIKQVSENLKRHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAE
VKEVVRVYLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
Download sequence
Identical sequences ENSGGOP00000000749 ENSGGOP00000000749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]