SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000785 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000785
Domain Number 1 Region: 33-198
Classification Level Classification E-value
Superfamily EF-hand 6.91e-45
Family Penta-EF-hand proteins 0.0000000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000785   Gene: ENSGGOG00000000796   Transcript: ENSGGOT00000000801
Sequence length 199
Comment pep:known_by_projection chromosome:gorGor3.1:7:85384351:85399325:-1 gene:ENSGGOG00000000796 transcript:ENSGGOT00000000801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQ
SGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTV
DPQELQKALTTMGRFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTA
QQGVVNFPYDDFIQCVMSV
Download sequence
Identical sequences ENSGGOP00000000785 ENSGGOP00000000785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]