SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000796 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000796
Domain Number 1 Region: 196-315
Classification Level Classification E-value
Superfamily EF-hand 1.14e-34
Family Osteonectin 0.028
Further Details:      
 
Domain Number 2 Region: 133-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000123
Family Ovomucoid domain III-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000796   Gene: ENSGGOG00000000808   Transcript: ENSGGOT00000000812
Sequence length 332
Comment pep:known_by_projection chromosome:gorGor3.1:5:120469388:120989419:-1 gene:ENSGGOG00000000808 transcript:ENSGGOT00000000812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRF
RDVSTGATRPRGAGGLLSLLCKTEALKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKGN
VAHKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLTTLCDGPCP
CLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQARFDTSI
LPICKDSLGWMFNKLDMNYDLLLDPSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNEW
CYCFQKPGGLPCQNEMNRIQKLSKGKSLLGKY
Download sequence
Identical sequences ENSGGOP00000000796 ENSGGOP00000000796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]