SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000816 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000816
Domain Number 1 Region: 498-678
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.75e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 365-465
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000641
Family WWE domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000816
Domain Number - Region: 177-200
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00146
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 295-326
Classification Level Classification E-value
Superfamily WWE domain 0.0222
Family WWE domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000816   Gene: ENSGGOG00000000828   Transcript: ENSGGOT00000000833
Sequence length 701
Comment pep:known_by_projection chromosome:gorGor3.1:7:138343062:138381658:-1 gene:ENSGGOG00000000828 transcript:ENSGGOT00000000833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAGVVGEVTQVLCAAGGALELPELRRRLRMGLSADALERLLRQRGRFVVAVRAGGXLS
PRSGVXXXASPLRLCRAHQGSKPGCVGLCAQLHLCRFMVYGACKFLRAGKNCRNSHSLTT
EHNLSVLRTHGVDHLSYNELCQLLFQNDPWLLPEICQHYNKGDGPHGSCAFQKQCIKLHI
CQYFLQGECKFGTSCKRSHDFSNSENLEKLEKLGMSSDLVSRLPTIYRNAHDIKNKSSAP
SRVPPLFVPQGTSERKDSSGSVSPNTLSQEEGDQICLYHIRKSCSFQDKCHRVHFHLPYR
WQFLDRGKWEDLDNMELIEEAYCNPKIERILCSESASTFHSHCLNFNAMTYGATQARRLS
TASSVTKPPHFILTTDWIWYWSDEFGSWQEYGRQGTAHPVTTVSSSDVEKAYLAYCTPGS
DGQAATLKFQAGKHNYELDFKAFVQKNLVYGTTKKVCRRPKYVSPQDVMTMQTCNTKFPG
PKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEV
YQWQKGQMQKQNGGKAVDERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGSYFARD
AAYSHHYSKSDTQTHMMFLARVLVGEFVRGNASFVRPPAKEGRSNAFYDSCVNSVSDPSI
FVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLFSSRQ
Download sequence
Identical sequences ENSGGOP00000000816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]