SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000821 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000821
Domain Number 1 Region: 63-203
Classification Level Classification E-value
Superfamily L domain-like 4.42e-34
Family Ngr ectodomain-like 0.0056
Further Details:      
 
Domain Number 2 Region: 256-525
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000484
Family Soluble quinoprotein glucose dehydrogenase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000821   Gene: ENSGGOG00000000834   Transcript: ENSGGOT00000000838
Sequence length 548
Comment pep:known_by_projection chromosome:gorGor3.1:8:22018129:22029055:-1 gene:ENSGGOG00000000834 transcript:ENSGGOT00000000838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLRARGGPGPGLLALSALGFCLMLQVSAKRPPKTPPCPPSCSCTRDTAFCVDSKAVPR
NLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFTGLSHLQYLFIE
NNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILNDLDLRGNSLNCDCKVKW
LVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFL
YSSDLYLALAQPGVSACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDSQLYVVVAQLF
GGSYIYHWDPNTTRFTRLQDIDPQRVRKPNDLEAFRIDGDWYFAVADSSKAGATSLYRWH
QNGFYSHQALHPWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQGEVTQV
PDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGRRY
LALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYR
HVVVDLSA
Download sequence
Identical sequences A0A2J8N990 G3QEW7 Q1EGL0
ENSGGOP00000000821 ENSPTRP00000054912 9598.ENSPTRP00000034338 ENSPTRP00000054912 ENSGGOP00000000821 NP_001065284.1.37143 XP_003823652.1.60992 XP_004046793.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]