SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000839 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000839
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily C-type lectin-like 6.83e-53
Family Link domain 0.0000000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000839   Gene: ENSGGOG00000000851   Transcript: ENSGGOT00000000857
Sequence length 742
Comment pep:known_by_projection chromosome:gorGor3.1:11:35717135:35809957:1 gene:ENSGGOG00000000851 transcript:ENSGGOT00000000857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIHPSNPTDDDVSS
GSSSERSSTSGGYIFYTFSTAHPIPDEDGPWITDSTDRIPATTLMSTSATATETATKRQE
TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
EDFISSTISTTPRAFDHTKENQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN
PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEGIATQKEQWFGNRWHEGYRQTPREDS
HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFDPISHPMGRGHQAGRRMDMDSSHSTT
LQPTANPNTDLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNH
SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET
PDQFMTADETRNLQNVDMKIGV
Download sequence
Identical sequences A0A2I2ZB03
ENSGGOP00000000839 ENSGGOP00000000839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]