SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000844 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000844
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily EF-hand 1.38e-23
Family S100 proteins 0.0000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000844   Gene: ENSGGOG00000000857   Transcript: ENSGGOT00000000862
Sequence length 114
Comment pep:known_by_projection chromosome:gorGor3.1:1:132332400:132335569:1 gene:ENSGGOG00000000857 transcript:ENSGGOT00000000862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Download sequence
Identical sequences G3QEY7 P06702
ENSGGOP00000000844 ENSGGOP00000000844 ENSP00000357727 gi|4506773|ref|NP_002956.1| 9606.ENSP00000357727 NP_002956.1.87134 NP_002956.1.92137 XP_004026771.1.27298 ENSP00000357727 ENSP00000357727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]