SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000849 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000849
Domain Number 1 Region: 135-176
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000183
Family SAP domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000849   Gene: ENSGGOG00000000864   Transcript: ENSGGOT00000000867
Sequence length 187
Comment pep:known_by_projection chromosome:gorGor3.1:10:15245332:15264745:-1 gene:ENSGGOG00000000864 transcript:ENSGGOT00000000867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCASPVAVVAFCTGLWVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLMDRGVNFSL
DTIEKELISFCLDTRGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLD
SQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAA
THPKTEL
Download sequence
Identical sequences G3QEZ2
XP_004049123.1.27298 ENSGGOP00000000849 ENSGGOP00000000849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]