SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000855 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000855
Domain Number 1 Region: 4-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.78e-125
Family Motor proteins 0.00000000387
Further Details:      
 
Domain Number 2 Region: 1696-1776
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.55e-29
Family Cap-Gly domain 0.00000547
Further Details:      
 
Domain Number 3 Region: 448-542
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.27e-24
Family FHA domain 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000855
Domain Number - Region: 873-954
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0271
Family PLC-like (P variant) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000855   Gene: ENSGGOG00000000863   Transcript: ENSGGOT00000000873
Sequence length 1828
Comment pep:known_by_projection chromosome:gorGor3.1:8:29075213:29270256:-1 gene:ENSGGOG00000000863 transcript:ENSGGOT00000000873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDSKVKVAVRIRPMNRRETDLHTKCVVDVDANKVILNPVNTNLSKGDARLWPKVFAYDH
CFWSMDESVKEKYAGQDIVFKCLGENILQNAFDGYNACIFAYGQTGSGKSYTMMGTADQP
GLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNEKVRDLLDPKGSRQTLKVREHSVLG
PYVDGLSKLAVTSYKDIESLMSEGNKSRTVAATNMNEESSRSHAVFKITLTHTLYDVKSG
TSGEKVGKLSLVDLAGSERATKTGAAGDRLKEGSNINKSLTTLGLVISALADQSAGKNKN
KFVPYRDSVLTWLLKDSLGGNSKTAMVATVSPAADNYDETLSTLRYADRAKHIVNHAVVN
EDPNARIIRDLREEVEKLREQLTKAEAMKSPELKDRLEESEKLIQEMTVTWEEKLRKTEE
IAQERQKQLESLGISLQSSGIKVGDDKCFLVNLNADPALNELLVYYLKEHTLIGSANSQD
IQLCGMGILPEHCIIDITSEGQVMLTPQKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFF
RLNLPKKKKKAEREDEDQDPSMKNENSSEQLDVDGDSSSEVSSEINFNYEYAQMEVTMKA
LGSNDPMQSILNSLEQQHEEEKRSALERQRLMYEHELEQLRRRLSPEKQNCRSMDRFSFH
SPSAQQRLRQWAEEREATLNNSLMKLREQIVKANLLVREANYIAEELDKRTEYKVTLQIP
ASSLDANRKRGSLLSEPAIQVRRKGKGKQIWSLEKLDNRLLDMRDLYQEWKECEEDNPVI
RSYFKRADPFYDEQENHSLIGVANVFLESLFYDVKLQYAVPIINQKGEVAGRLHVEVMRL
SGDVGERIAGGDEVAEVSFEKETQENKLVCMVKILQATGLPQHLSHFVFCKYSFWDQQEP
VIVAPEVDTSSSSVSKEPHCMVVFDHCNEFSVNITEDFIEHLSEGALAIEVYGHKINDPR
KNPALWDLGIIQAKTRSLRDRWSEVTRKLEFWVQILEQNENGEYCPVEVISAKDVPTGGI
FQLRQGQSRRVQVEVKSVQESGTLPLMEECILSVGIGCVKVRPLRAPRTHDTFHEEEEDM
DSYQDRDLERLRRKWLNALTKRQEYLDQQLQKLVSKRDKTEDDADREAQLLEMRLTLTEE
RNAVMVPSAGSGIPGAPAEWTPVPGMETHIPVIFLDLNADDFSSQDNLDDPEAGGWDATL
TGEEEEEFFELQIVKQHDGEVKAEASWDSAVHGCPQLSRGTPADERLFLIVRVTVQLSHP
ADMQLVLRKRICVNVHGRQGFAQSLLKKMSHRSSIPGCGVTFEIVSNIPEDAQGVEEREA
LARMAANVENPASADSEAYIEKYLRSVLAVENLLTLDRLRQEVAVKEQLTGKGKLSRRSI
SSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPD
PGLSNLAASYLNPVKSFVPQMPKLLKSLFPVRDEKRGKRPSPLAHQPVPRIMVQSASPDI
RVTRMEEAQPEMGPDVLVQTMGAPALKICDKPAKVPSPPPVVAVTAVTPAPAPEAQDGPP
SPLSEASSGYFSHSVSTATLSDALGPGLDAAAPPGSMPTAPEAEPEAPISHPPPPTAVPA
EEPPGPQQLVSPGRERPDLEAPAPGSPFRVRRVRASELRSFSRMLAGDPGCSPGAEGNAP
AAGAGGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLP
SGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSA
TNLASLTAALAKADRSHKNPENRKSWAS
Download sequence
Identical sequences ENSGGOP00000017048 ENSGGOP00000000855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]