SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000867 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000000867
Domain Number - Region: 145-190
Classification Level Classification E-value
Superfamily EF-hand 0.0158
Family Calmodulin-like 0.08
Further Details:      
 
Domain Number - Region: 197-317
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.051
Family RIO1-like kinases 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000867   Gene: ENSGGOG00000000881   Transcript: ENSGGOT00000000886
Sequence length 428
Comment pep:known_by_projection chromosome:gorGor3.1:1:95315041:95462827:-1 gene:ENSGGOG00000000881 transcript:ENSGGOT00000000886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSLCPGACLRNPFYSQARFSYVRMKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCK
KIICDKYKTGVIDGPACNSLCVTETLYFGKCLSTKPNNQMYLGIWDNLPGVVKCQMEQAL
HLDFGTELEPRKEIVLFDKPTRGTTVQKFKEMVYSLFKAKLGDQGNLSELVNLILTVADG
DKDGQVSLGEAKSAWALLQLNEFLLMVILQDKEHTPKLMGFCGDLYVMESVEYTSLYGIS
LPWVIELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVEDVFHGPYGNFLMCDTSAKNL
GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQSTMKCTSEVIQ
PNLAKACQLLKDYLLRGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWK
KISYTNDS
Download sequence
Identical sequences ENSGGOP00000000867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]