SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000887 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000887
Domain Number 1 Region: 16-81,213-369,492-579
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.86e-27
Family WD40-repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000887
Domain Number - Region: 35-50,103-240
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000165
Family Quinohemoprotein amine dehydrogenase B chain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000887   Gene: ENSGGOG00000000899   Transcript: ENSGGOT00000000906
Sequence length 1531
Comment pep:known_by_projection chromosome:gorGor3.1:10:117734972:117820811:-1 gene:ENSGGOG00000000899 transcript:ENSGGOT00000000906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLRNWESSIILCKKSQPGMDVNQMSFNPMNWRQLCLSSPSTVSVWTIERSNQEHYFRAR
SVKLPLEDGSFFNEMDVVFPQSLPKDLIYGPVLPLSAIAGLVGEEAETFRPKDDLYPLLH
PTMHCWTPTSDLYIGCEEGHLLMINGDTLQVTVLNKIEEESPLEDRRNFISPVTLVYQKE
GLLASGIDGFVYSFIIKDRSYMIEDFLEIERPVGHMTFSPNYTMLLIQTDKGSVYIYTFG
KEPTLNKVLDACDGKFQAIDFITPGTQYFMTLTHSGEICIWWLEDCACVSKIYLNTLATV
LACCPSSLSAAVGTEGGSVYFISVYDKESPQVVHKTFLSESSVQHVVYDQQGIFLLVGTS
EGKVFIINANSSSSFQIIGFTEVAKDILQISTVSLLETDIVEVMVLSSLPEAERSRLEMF
TLPTLLPQVSTTFADERGRLKDEIIHKYLYELEHALSSAVLGFQSNQIYGFCSQVPYICS
YLLPEEEHTGIYILKPYKKVQSRQYGPGMLYLSSHGLWLITIAKCGILCIRDVYTLETFA
RCRSHSHQGHGIQSMRISMDGQNILVNGRDDGTLVYLKWKQFGGHLASEILDYYQKLLIS
LSSAMDKENHYLSTTPKVSVDLGSDSEHTKQKASTDLSQDELVLTDVKKEIPWIQQKSQE
AIKKEVNLFSKKRKEIKQGIKSLSKTILNMMEENDKLENIAKLDQQEFGLDLEELERLHD
ESQEEVAKMIKDVEMHNLAKSYLAELIKEECWNSMAVKGRALKCFHIPCVVENFPMKART
VEELKELERVLQQKKIEAECLKLRKEIVEAQSGVKLIKQRHEEDDEEEEEEDRTVKYSNL
PNYLLGSLSTDFGVDTSLLSSQLELHSREEKINQIILLKDIIYKVKTAFNNEFDAAYKQK
EFEIARVKERNVRIREIILDLELEEAVWQPEFEDCEKPERTLVVQDEEITAHKHIKPWHK
AKELIVNHETEHWLLIQDASTRLRALMDMMGGVLEVKKEDILRMVIPQPAFMAKPDAVWT
EEERKQFKDYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQAFDEHLKRLFERRVKA
EMVTNQEELKISNLAFSLLLDEELSSREKFLNNYLTRKQHEKSQTSEAVRKSREDLDVYK
EHYDNLLAEDKVMDRSFKKEFSEIPGHQVDILYKLFKRRPRISKQKTHSETTSVVPFGEL
PGSGKLNKDAFAQLMKAMDELDNISNMPEGLDPLVWNHFCMTRRAKVENEQKVKQKAADL
LEMATFLQKRVEEEEKVQQEIERVFHELILLQEEKVRFQLNLTIQILLKQGQVELENFQL
VLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKDVHKRILQIEWEHKKMEMEREDL
NQKAWDIQMLFFSRDRQKYLNEPNYEALINIQIGIMEQTIAVLDKTHKKNVENCKKLLKK
LGKFSNQKDIANYALSCNLREELVAVSERKDICNAMGSKLTCEKIVKERYENMMQQQKLT
NISKQQAEQISILQTEVERLRMKTFPALVQM
Download sequence
Identical sequences ENSGGOP00000000887 ENSGGOP00000000887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]