SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000958 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000958
Domain Number 1 Region: 186-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-54
Family Voltage-gated potassium channels 0.0009
Further Details:      
 
Domain Number 2 Region: 15-129
Classification Level Classification E-value
Superfamily POZ domain 6.08e-33
Family Tetramerization domain of potassium channels 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000958   Gene: ENSGGOG00000000972   Transcript: ENSGGOT00000000979
Sequence length 491
Comment pep:known_by_projection chromosome:gorGor3.1:2a:18223736:18288205:1 gene:ENSGGOG00000000972 transcript:ENSGGOT00000000979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR
YQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCIHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVR
LAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYQEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC
WWWATISMTTVGYGDTHPVTLPGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID
VDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDIC
NTTSLENCTAK
Download sequence
Identical sequences G3QF91
ENSGGOP00000000958 XP_004028924.1.27298 XP_018876148.1.27298 ENSGGOP00000000958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]