SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000981 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000981
Domain Number 1 Region: 73-165
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000384
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000981   Gene: ENSGGOG00000000996   Transcript: ENSGGOT00000001002
Sequence length 172
Comment pep:novel chromosome:gorGor3.1:21:492736:646656:-1 gene:ENSGGOG00000000996 transcript:ENSGGOT00000001002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESPQTSEFKGATEEAPAKESPHTGEFKGAALVSPISESVLARLSKFEVEDAENVASYD
SKIKKIVHSIVSSFAFGLFGVFLVLLDVTLVLADLIFTDSKLYIPLEYRSISLAIALFFL
MDVLLRVFVEGWTHLLRLLRLIILLRIFHLFHQKRQLEKLLRRRVSENKRRY
Download sequence
Identical sequences ENSGGOP00000000981 ENSGGOP00000000981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]