SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000993 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000993
Domain Number 1 Region: 40-111
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.22e-16
Family SNARE fusion complex 0.0029
Further Details:      
 
Domain Number 2 Region: 189-260
Classification Level Classification E-value
Superfamily SNARE fusion complex 6.54e-16
Family SNARE fusion complex 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000993   Gene: ENSGGOG00000001007   Transcript: ENSGGOT00000001015
Sequence length 260
Comment pep:known_by_projection chromosome:gorGor3.1:22:4721287:4751530:1 gene:ENSGGOG00000001007 transcript:ENSGGOT00000001015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLSDGPDAPADRQQYLRQEVLRRAEATAAST
SRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLV
NYFKSKPVETPPEQNGTLTSQPNSRLKEAISTSKEQEAKYQASHPNLRKLDDTDLDPVPR
GAGSAVSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLT
TKVDKLDVNIKSTERKVRQL
Download sequence
Identical sequences ENSGGOP00000000993 ENSGGOP00000000993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]