SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001010 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001010
Domain Number 1 Region: 1194-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 3.45e-77
Family Endostatin 0.0000000599
Further Details:      
 
Domain Number 2 Region: 40-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.33e-35
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 3 Region: 841-1000
Classification Level Classification E-value
Superfamily C-type lectin-like 1.51e-26
Family Endostatin 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001010   Gene: ENSGGOG00000001022   Transcript: ENSGGOT00000001033
Sequence length 1366
Comment pep:known_by_projection chromosome:gorGor3.1:9:81061760:81193552:1 gene:ENSGGOG00000001022 transcript:ENSGGOT00000001033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRNNGQCWCLLMLLSVSTPLPAVTQTGGATETASQGHLDLTQLIGVPLPSSVSFVTG
YGGFPAYSFGPGANVGRPARTLIPSTFFRDFAISVVVKPSSTRGGVLFAITDAFQKVIYL
GLRLSGVEDGHQRIILYYTEPGSHVSQEAAAFSVPVMTHRWNRFAMIVQGEEVTLLVNCE
EHSRIPFQRSSQALAFESSAGIFVGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEES
SASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPEG
TPETTNMSIIQHSSPEQGSGEILNDTLEGVHSVDGDPITESGSGAGAFLDIAEEENLAAT
AAGLAEVPISTAGEAEASSVPTGGPTLSMSTENPEEGVTPGPDNEEGLAATAAGEAEALA
SMPGEVEASGVAPGELDLSMSAQSLGEEATVSPSSEDSLTTAAAATEASLSTFEDEEASG
PGDEEDLAAATTEEPLITAGGEESGSPPPDGPPLPLPTVAPERWVTPAQREHVGVKGQAG
PKGEKGDAGEELPGPPEPSGPVGPTAGAEAEGSGLGWGSDVGSGSGDLVGSEQLLRGPPG
PPGPPGLPGIPGKPGTDVFMGPPGSPGEDGPAGEPGPPGPEGQPGVDGATGLPGMKGEKG
ARGPNGSVGEKGDPGNRGLPGPPGKKGQAGPPGVMGPPGPPGPPGPPGPGCTMGLGFEDT
EGSGSTQLLNEPKLSRRTAAIGLKGEKGDRGPKGERGMDGASIVGPPGPRGPPGHIKVLS
NSLINITHGFMNFSDIPELVGPPGPDGLPGLPGFPGPRGPKGDTGLPGFPGLKGEQGEKG
EPGAILTGDIPLERLMGKKGEPGMHGAPGPMGPKGPPGHKGEFGLPGRPGRPGLNGLKGT
KGDPGVIMQGPPGLPGPPGPPGPPGAVINIKGAIFPIPIRPHCKMPVDTAHPGSPELITF
HGVKGEKGSWGLPGSKGEKGDQGAQGPPGPPLDLAYLRHFLNNLKGENGDKGFKGEKGEK
GDINDSFLMSGPPGLPGNPGLAGQKGETVVGPQGPPGAPGLPGPPGFGRPGDPGPPGPPG
PPGPPAILGAAVALPGPPGPPGQPGLPGSRNLVTAFSNMDDMLQKAHLVIEGTFIYLRDS
TEFFIRVRDGWKKLQLGELIPIPADSPPPPALSSNPHQLLPPPNPISSANYEKPALHLAA
LNMPFSGDIRADFQCFKQARAAGLLSTYRAFLSSHLQDLSTIVRKAERYSLPIVNLKGQV
LFNNWESIFSGHGGQFNMHLPIYSFDGRDIMTDPSWPQKVIWHGSSPHGIRLVDNYCEAW
RTADTAVTGLASPLSTGKILDQKAYSCANRLIVLCIENSFMTDARK
Download sequence
Identical sequences ENSGGOP00000001010 ENSGGOP00000001010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]