SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001022 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000001022
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000314
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001022   Gene: ENSGGOG00000001038   Transcript: ENSGGOT00000001046
Sequence length 424
Comment pep:known_by_projection chromosome:gorGor3.1:7:23450646:23469092:1 gene:ENSGGOG00000001038 transcript:ENSGGOT00000001046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAICQFFLQGRCRFGDRCWNEHPGARGVGVGRQQPQQQPSGNNRRGWNTTSQRYSNVIQP
SSFSKSTPWGGSRDQEKPYFSSFDSGASTNRKAGFGLSENPFASLSPDEQKDEKKFLEGI
VKDMEVWESSGQWMFSVYSPVKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQR
LINQWRNRVNELKSLNISTKVALLSDVKDGVNQAAPAFGFGSSQAATFMSPVGFPVNNSS
SDNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSGISTSAPAFGFGKPEVTSAA
SFSFKSPAASSFGSPGFSGLPTSLATGPVRAPVAPAFGGGSSVAGFGSPGSHSHTAFSKP
SSDTFGNSSISTSLSASSSIIATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLE
LLNI
Download sequence
Identical sequences ENSGGOP00000001022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]